Structure of PDB 2oj2 Chain A Binding Site BS01

Receptor Information
>2oj2 Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQM
VVLEESGEWWKARSLATRKEGYIPSNYVARVDSLET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oj2 Solution Structure of a Hck SH3 Domain Ligand Complex Reveals Novel Interaction Modes
ResolutionN/A
Binding residue
(original residue number in PDB)
Y32 H38 H39 S56 E58 W59 W60 Y72 P74 N76 Y77
Binding residue
(residue number reindexed from 1)
Y32 H38 H39 S56 E58 W59 W60 Y72 P74 N76 Y77
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:2oj2, PDBe:2oj2, PDBj:2oj2
PDBsum2oj2
PubMed17141806
UniProtP08631|HCK_HUMAN Tyrosine-protein kinase HCK (Gene Name=HCK)

[Back to BioLiP]