Structure of PDB 2oi9 Chain A Binding Site BS01

Receptor Information
>2oi9 Chain A (length=175) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVP
WMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYG
CDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQA
GAAEYYRAYLEGECVEWLHRYLKNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oi9 How a single T cell receptor recognizes both self and foreign MHC.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
Y7 R62 I63 W73 N77 L81 Y84 R97 Y99 K146 W147 A150 A152 Y155 Y156 Y159 E163 W167
Binding residue
(residue number reindexed from 1)
Y7 R62 I63 W73 N77 L81 Y84 R97 Y99 K146 W147 A150 A152 Y155 Y156 Y159 E163 W167
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2oi9, PDBe:2oi9, PDBj:2oi9
PDBsum2oi9
PubMed17418792
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]