Structure of PDB 2og0 Chain A Binding Site BS01

Receptor Information
>2og0 Chain A (length=51) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
D
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2og0 Fis targets assembly of the xis nucleoprotein filament to promote excisive recombination by phage lambda.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		S17 E19 T20 R23
Binding residue
(residue number reindexed from 1)		S17 E19 T20 R23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2og0, PDBe:2og0, PDBj:2og0
PDBsum2og0
PubMed17275024
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]