Structure of PDB 2ofq Chain A Binding Site BS01

Receptor Information
>2ofq Chain A (length=95) Species: 179945 (IncN plasmid R46) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFEFPANAELPQVYMISAS
GKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAP
Ligand information
>2ofq Chain B (length=22) Species: 179945 (IncN plasmid R46) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPEPDWSNTVPVNKTIPVDTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ofq NMR structure of a complex between the VirB9/VirB7 interaction domains of the pKM101 type IV secretion system
ResolutionN/A
Binding residue
(original residue number in PDB)		Y182 Y184 V185 M186 S187 E188 Q189 M192 H199 V200 D259 K260 V261 G263 V264 R265
Binding residue
(residue number reindexed from 1)		Y6 Y8 V9 M10 S11 E12 Q13 M16 H23 V24 D83 K84 V85 G87 V88 R89
Enzymatic activity
Enzyme Commision number ?
External links