Structure of PDB 2ofi Chain A Binding Site BS01

Receptor Information

>2ofi Chain A (length=184) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQRCDWVSQDPLYIAYHDNEWGVPETDSRKLFEMICLEGQQAGLSWITVL
KKRENYRACFHQFDPIRIAAMQEEDVERLLQNTGIIRHRGKIQAIISNAR
AWLAMEQNGESFADFVWSFVDGQPQITQAASLDKIPTSTPASDALAKALK
KRGFKFVGTTICYSFMQACGLVNDHITGCFCHPG

Ligand information

>2ofi Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccgttagtccgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ofi DNA damage recognition and repair by 3-methyladenine DNA glycosylase I (TAG).
Resolution	1.85 Å
Binding residue (original residue number in PDB)	L44 T48 I86 R87 K91
Binding residue (residue number reindexed from 1)	L44 T48 I86 R87 K91

Enzymatic activity

Enzyme Commision number

3.2.2.20: DNA-3-methyladenine glycosylase I.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0008725	DNA-3-methyladenine glycosylase activity
GO:0016798	hydrolase activity, acting on glycosyl bonds
GO:0046872	metal ion binding

	Biological Process
GO:0006281	DNA repair
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2ofi, PDBe:2ofi, PDBj:2ofi
PDBsum	2ofi
PubMed	17410210
UniProt	Q8Z2A5

[Back to BioLiP]