Structure of PDB 2oeh Chain A Binding Site BS01

Receptor Information
>2oeh Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYET
ITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPL
PPIKPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oeh Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
ResolutionN/A
Binding residue
(original residue number in PDB)		R24 I25 P26 Y27 L28 G29 G69 S72 C76 H80 R106
Binding residue
(residue number reindexed from 1)		R24 I25 P26 Y27 L28 G29 G69 S72 C76 H80 R106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2oeh, PDBe:2oeh, PDBj:2oeh
PDBsum2oeh
PubMed17407261
UniProtQ14865|ARI5B_HUMAN AT-rich interactive domain-containing protein 5B (Gene Name=ARID5B)

[Back to BioLiP]