Structure of PDB 2odd Chain A Binding Site BS01

Receptor Information

>2odd Chain A (length=50) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ

Ligand information

>2odd Chain B (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TISNPPPLISSAK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2odd Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity.
Resolution	N/A
Binding residue (original residue number in PDB)	S671 E672 T673 C674 S675 G676 Q688 H689 W692 E693
Binding residue (residue number reindexed from 1)	S14 E15 T16 C17 S18 G19 Q31 H32 W35 E36

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003714	transcription corepressor activity

	Biological Process
GO:0045892	negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2odd, PDBe:2odd, PDBj:2odd
PDBsum	2odd
PubMed	17560331
UniProt	Q06455\|MTG8_HUMAN Protein CBFA2T1 (Gene Name=RUNX1T1)

[Back to BioLiP]