Structure of PDB 2o8k Chain A Binding Site BS01

Receptor Information
>2o8k Chain A (length=63) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYR
EMLGIPSSRERRI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2o8k Structural basis of DNA recognition by the alternative sigma-factor, sigma54.
ResolutionN/A
Binding residue
(original residue number in PDB)		S39 D40 R56 A60 R63 E64 S70
Binding residue
(residue number reindexed from 1)		S26 D27 R43 A47 R50 E51 S57
Binding affinityPDBbind-CN: Kd=114nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001216 DNA-binding transcription activator activity
GO:0016987 sigma factor activity

View graph for
Molecular Function
External links
PDB RCSB:2o8k, PDBe:2o8k, PDBj:2o8k
PDBsum2o8k
PubMed17481658
UniProtO66858

[Back to BioLiP]