Structure of PDB 2o49 Chain A Binding Site BS01

Receptor Information
>2o49 Chain A (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTAS
QSLLVNLRAMQNFLQLPEAERDRIYQDERERSLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2o49 Structural basis for recognition of the matrix attachment region of DNA by transcription factor SATB1.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R400 T401 L404 S421 N425
Binding residue
(residue number reindexed from 1)		R31 T32 L35 S52 N56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006338 chromatin remodeling

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2o49, PDBe:2o49, PDBj:2o49
PDBsum2o49
PubMed17652321
UniProtQ01826|SATB1_HUMAN DNA-binding protein SATB1 (Gene Name=SATB1)

[Back to BioLiP]