Structure of PDB 2ntc Chain A Binding Site BS01

Receptor Information
>2ntc Chain A (length=127) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSV
TFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYL
MYSALTRDPFSVIEESLPGGLKEHDFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ntc The Crystal Structure of the SV40 T-Antigen Origin Binding Domain in Complex with DNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N153 T155 R202 H203 R204 A207
Binding residue
(residue number reindexed from 1)		N22 T24 R71 H72 R73 A76
Binding affinityPDBbind-CN: Kd=60nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ntc, PDBe:2ntc, PDBj:2ntc
PDBsum2ntc
PubMed17253903
UniProtQ98ZP7

[Back to BioLiP]