Structure of PDB 2npm Chain A Binding Site BS01

Receptor Information

>2npm Chain A (length=237) Species: 5807 (Cryptosporidium parvum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSDSVNARESNVYMAKLAEQAERYDEMAKYMKDVVEARQEELTVEERNLL
SVAYKNAVGSRRSSWRIISSVEQKEHSRNAEDASKMCGKYRSKVEAELTD
ICNDILTMLDKHLIPTATSPDSKVFYFKMKGDYHRYISEFSTGDSKQSSA
EDALKAYKDATVVAKDLEPTHPIRLGLALNFSVFHYEILNEPRAAIDMAK
EAFEMAIEQLDKLSEDCYKDSTLIMQLLRDNLTLWTA

Ligand information

>2npm Chain X (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RAISLP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2npm Characterization of 14-3-3 proteins from Cryptosporidium parvum.
Resolution	2.52 Å
Binding residue (original residue number in PDB)	K77 R84 R157 Y158 L201 N202 N253 W257
Binding residue (residue number reindexed from 1)	K55 R62 R135 Y136 L179 N180 N231 W235

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0007165	signal transduction

	Cellular Component
GO:0005737	cytoplasm

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2npm, PDBe:2npm, PDBj:2npm
PDBsum	2npm
PubMed	21853016
UniProt	Q5CUW0

[Back to BioLiP]