Structure of PDB 2np2 Chain A Binding Site BS01

Receptor Information

>2np2 Chain A (length=102) Species: 139 (Borreliella burgdorferi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RPKVTKSDIVDQIALNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVI
EFRSFGTFEVRKRKGRLNARNPQTGEYVKVLDHHVAYFRPGKDLKERVWG
IK

Ligand information

>2np2 Chain C (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtatttaatactatatgtcatatagtattaaatact

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2np2 Shaping the Borrelia burgdorferi genome: crystal structure and binding properties of the DNA-bending protein Hbb.
Resolution	3.02 Å
Binding residue (original residue number in PDB)	E56 F57 R58 R68 K69 R71 N73 R75 P77 Q78 Y92
Binding residue (residue number reindexed from 1)	E51 F52 R53 R63 K64 R66 N68 R70 P72 Q73 Y87
Binding affinity	PDBbind-CN: Kd=55nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0030527	structural constituent of chromatin

	Biological Process
GO:0030261	chromosome condensation

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2np2, PDBe:2np2, PDBj:2np2
PDBsum	2np2
PubMed	17244195
UniProt	Q57267\|DBH_BORBU DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]