Structure of PDB 2nnu Chain A Binding Site BS01

Receptor Information
>2nnu Chain A (length=201) Species: 333760 (Human papillomavirus 16) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREM
GFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSL
EVYLTAPTGCIKKHGYTVEVQFDGDICNTMHYTNWTHIYICEEASVTVVE
GQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSV
F
Ligand information
>2nnu Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATIDMNFQSDLLSIFEENLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nnu Structure of the Papillomavirus DNA-Tethering Complex E2:Brd4 and a Peptide that Ablates HPV Chromosomal Association.
Resolution1.59 Å
Binding residue
(original residue number in PDB)		S0 R7 R37 Y44 K66 A69 L70 I73
Binding residue
(residue number reindexed from 1)		S1 R8 R38 Y45 K67 A70 L71 I74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
GO:0016032 viral process

View graph for
Biological Process
External links
PDB RCSB:2nnu, PDBe:2nnu, PDBj:2nnu
PDBsum2nnu
PubMed17189190
UniProtP03120|VE2_HPV16 Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]