Structure of PDB 2nna Chain A Binding Site BS01

Receptor Information
>2nna Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLF
RRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVT
LGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKI
SYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nna A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y9 Y22 R52 R53 F54 N62 V65 H68 N69 I72 R76
Binding residue
(residue number reindexed from 1)		Y10 Y24 R54 R55 F56 N64 V67 H70 N71 I74 R78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2nna, PDBe:2nna, PDBj:2nna
PDBsum2nna
PubMed17629515
UniProtP01909|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]