Structure of PDB 2nla Chain A Binding Site BS01

Receptor Information
>2nla Chain A (length=150) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQ
RNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFG
AFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
Ligand information
>2nla Chain B (length=21) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DECAQLRRIGDKVNLRQKLLN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nla Structural insights into the degradation of Mcl-1 induced by BH3 domains.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
H224 M231 V253 D256 N260 G262 R263 T266 F318 F319 V321
Binding residue
(residue number reindexed from 1)
H53 M60 V82 D85 N89 G91 R92 T95 F147 F148 V150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2nla, PDBe:2nla, PDBj:2nla
PDBsum2nla
PubMed17389404
UniProtP97287|MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Gene Name=Mcl1);
Q07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]