Structure of PDB 2nl9 Chain A Binding Site BS01

Receptor Information
>2nl9 Chain A (length=142) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDLYRQSLEIISRYLREQATGSGAAGRRALETLRRVGDGVQRNHETAFQG
MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKT
INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
Ligand information
>2nl9 Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPEIWIAQELRRIGDEFNAYYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nl9 Structural insights into the degradation of Mcl-1 induced by BH3 domains.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		V220 H224 M231 K234 L235 S245 R248 V249 H252 V253 D256 N260 G262 R263 V265 T266 F318 F319
Binding residue
(residue number reindexed from 1)		V40 H44 M51 K54 L55 S65 R68 V69 H72 V73 D76 N80 G82 R83 V85 T86 F138 F139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2nl9, PDBe:2nl9, PDBj:2nl9
PDBsum2nl9
PubMed17389404
UniProtP97287|MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Gene Name=Mcl1);
Q07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]