Structure of PDB 2nl8 Chain A Binding Site BS01

Receptor Information
>2nl8 Chain A (length=117) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVT
FISRHNSYNHNILFFLTPHRHRVSAINNYAQKLSTFSFLICKGVNKEYLM
YSALTRDPFSVIEESLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nl8 Structure of the origin-binding domain of simian virus 40 large T antigen bound to DNA
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N153 T155 R202 H203 R204 A207 N210
Binding residue
(residue number reindexed from 1)		N21 T23 R70 H71 R72 A75 N78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2nl8, PDBe:2nl8, PDBj:2nl8
PDBsum2nl8
PubMed17139255
UniProtQ98ZP7

[Back to BioLiP]