Structure of PDB 2nd1 Chain A Binding Site BS01

Receptor Information
>2nd1 Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPD
EIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nd1 Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
ResolutionN/A
Binding residue
(original residue number in PDB)		K15 S19 N23 K24 L25 P26 D50 E51 I52 E53 I54 D55 K80
Binding residue
(residue number reindexed from 1)		K15 S19 N23 K24 L25 P26 D50 E51 I52 E53 I54 D55 K80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2nd1, PDBe:2nd1, PDBj:2nd1
PDBsum2nd1
PubMed27291650
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]