Structure of PDB 2nd0 Chain A Binding Site BS01

Receptor Information
>2nd0 Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPD
EIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Ligand information
>2nd0 Chain B (length=19) Species: 37296 (Human gammaherpesvirus 8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NLQSSIVKFKKPLPLTQPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nd0 Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y12 S19 L30 P49 D50 E51 I52 E53 I54 F56
Binding residue
(residue number reindexed from 1)		Y12 S19 L30 P49 D50 E51 I52 E53 I54 F56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2nd0, PDBe:2nd0, PDBj:2nd0
PDBsum2nd0
PubMed27291650
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]