Structure of PDB 2n8t Chain A Binding Site BS01

Receptor Information
>2n8t Chain A (length=39) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2n8t Structural Studies of the Nedd4 WW Domains and Their Selectivity for the Connexin43 (Cx43) Carboxyl Terminus.
ResolutionN/A
Binding residue
(original residue number in PDB)
D15 Y21 V23 H25 S27 T29 T30 T31
Binding residue
(residue number reindexed from 1)
D15 Y21 V23 H25 S27 T29 T30 T31
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:2n8t, PDBe:2n8t, PDBj:2n8t
PDBsum2n8t
PubMed26841867
UniProtQ62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 (Gene Name=Nedd4)

[Back to BioLiP]