Structure of PDB 2n8m Chain A Binding Site BS01

Receptor Information
>2n8m Chain A (length=191) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGPSSVSGAAPFSSFMPPEQETVHVFIPAQAVGAIIGDDGQHIKQLSR
FASASIKIAPPETPDSKVRMVVITGPPEAQFKAQGRIYGKLKEENFFGPK
EEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENE
QVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSGQLQA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2n8m KH domains with impaired nucleic acid binding as a tool for functional analysis.
ResolutionN/A
Binding residue
(original residue number in PDB)		G117 R118 I120 K122 G123 V139 V140 P141 R142 D143 Q180
Binding residue
(residue number reindexed from 1)		G117 R118 I120 K122 G123 V139 V140 P141 R142 D143 Q180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2n8m, PDBe:2n8m, PDBj:2n8m
PDBsum2n8m
PubMed
UniProtO42254|IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 (Gene Name=IGF2BP1)

[Back to BioLiP]