Structure of PDB 2n8l Chain A Binding Site BS01

Receptor Information

>2n8l Chain A (length=191) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGPSSVSGAAPFSSFMPPEQETVHVFIPAQAVGAIIGKKGQHIKQLSR
FASASIKIAPPETPDSKVRMVVITGPPEAQFKAQGRIYGKLKEENFFGPK
EEVKLETHIRVPASAAGRVIGDDGKTVNELQNLTAAEVVVPRDQTPDENE
QVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSGQLQA

Ligand information

>2n8l Chain B (length=8) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcacaccc

........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2n8l ZBP1 recognition of beta-actin zipcode induces RNA looping.
Resolution	N/A
Binding residue (original residue number in PDB)	V34 G35 I38 G39 K40 K41 G42 K46 K57 I58 R69
Binding residue (residue number reindexed from 1)	V34 G35 I38 G39 K40 K41 G42 K46 K57 I58 R69

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:2n8l, PDBe:2n8l, PDBj:2n8l
PDBsum	2n8l
PubMed
UniProt	O42254\|IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 (Gene Name=IGF2BP1)

[Back to BioLiP]