Structure of PDB 2n3o Chain A Binding Site BS01

Receptor Information
>2n3o Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLM
LKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS
SPNQARAQAALQAVNSVQSGNLA
Ligand information
>2n3o Chain B (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggaccuggucuuuccagguccc
<<<<<<<<<.....>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2n3o C-terminal helix folding upon pyrimidine-rich hairpin binding to PTB RRM1. Implications for PTB function in Encephalomyocarditis virus IRES activity.
ResolutionN/A
Binding residue
(original residue number in PDB)		S51 R52 H62 R64 K65 L89 L91 K92 G93 K94 Q96 F98 N132 H133 K137 S140 S141 N143
Binding residue
(residue number reindexed from 1)		S11 R12 H22 R24 K25 L49 L51 K52 G53 K54 Q56 F58 N92 H93 K97 S100 S101 N103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2n3o, PDBe:2n3o, PDBj:2n3o
PDBsum2n3o
PubMed
UniProtP26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]