Structure of PDB 2n23 Chain A Binding Site BS01

Receptor Information
>2n23 Chain A (length=115) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQA
TPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNI
KMTLQQIISRYKDAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2n23 Structural Characterization of the Complex between the N-terminal Transactivation Domain of EKLF and the p62/Tfb1 subunit of TFIIH
ResolutionN/A
Binding residue
(original residue number in PDB)
A50 T51 S54 S55 K57 M59 R61 M88
Binding residue
(residue number reindexed from 1)
A50 T51 S54 S55 K57 M59 R61 M88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2n23, PDBe:2n23, PDBj:2n23
PDBsum2n23
PubMed
UniProtP32776|TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 (Gene Name=TFB1)

[Back to BioLiP]