Structure of PDB 2mzd Chain A Binding Site BS01

Receptor Information
>2mzd Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCK
RKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQK
Ligand information
>2mzd Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPSQAMDDLMLSPDDIEQWFTEDPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mzd Characterization of the p300 Taz2-p53 TAD2 Complex and Comparison with the p300 Taz2-p53 TAD1 Complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		R9 R10 S12 I13 Q14 R15 I17 S19 S35 K38 M39 V42 I59 Q62 A65 L66 Y69 H70 H73 C74
Binding residue
(residue number reindexed from 1)		R9 R10 S12 I13 Q14 R15 I17 S19 S35 K38 M39 V42 I59 Q62 A65 L66 Y69 H70 H73 C74
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2mzd, PDBe:2mzd, PDBj:2mzd
PDBsum2mzd
PubMed25753752
UniProtQ09472|EP300_HUMAN Histone acetyltransferase p300 (Gene Name=EP300)

[Back to BioLiP]