Structure of PDB 2mz1 Chain A Binding Site BS01

Receptor Information
>2mz1 Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKG
FAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSA
AEMYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mz1 Structural and mechanistic insights into poly(uridine) tract recognition by the hnRNP C RNA recognition motif.
ResolutionN/A
Binding residue
(original residue number in PDB)		N4 V5 T6 N7 R17 F19 G21 N22 H49 G51 F52 F54 D81 A85 P88 R92 G93 K94 A95 G96
Binding residue
(residue number reindexed from 1)		N3 V4 T5 N6 R16 F18 G20 N21 H48 G50 F51 F53 D80 A84 P87 R91 G92 K93 A94 G95
Binding affinityPDBbind-CN: Kd=11uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2mz1, PDBe:2mz1, PDBj:2mz1
PDBsum2mz1
PubMed25216038
UniProtP07910|HNRPC_HUMAN Heterogeneous nuclear ribonucleoproteins C1/C2 (Gene Name=HNRNPC)

[Back to BioLiP]