Structure of PDB 2my3 Chain A Binding Site BS01

Receptor Information
>2my3 Chain A (length=118) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGE
SQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE
AVKEELDRDIVSKNNAEK
Ligand information
>2my3 Chain B (length=23) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSKSQYIDIMPDFSPSGLLELES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2my3 Structures of intermediates during RES complex assembly.
ResolutionN/A
Binding residue
(original residue number in PDB)		E21 L22 T23 E24 G25 D26 L28 R44 E46 N47 G78 K97 Y98 A101 E105
Binding residue
(residue number reindexed from 1)		E21 L22 T23 E24 G25 D26 L28 R44 E46 N47 G78 K97 Y98 A101 E105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2my3, PDBe:2my3, PDBj:2my3
PDBsum2my3
PubMed26212312
UniProtP40565|IST3_YEAST U2 snRNP component IST3 (Gene Name=IST3)

[Back to BioLiP]