Structure of PDB 2mx6 Chain A Binding Site BS01

Receptor Information
>2mx6 Chain A (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEP
GDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mx6 Protein-ligand interaction decoded by NMR chemical shift analysis
ResolutionN/A
Binding residue
(original residue number in PDB)		L262 G263 I264 S265 I266 M284 V318 R322 V325
Binding residue
(residue number reindexed from 1)		L15 G16 I17 S18 I19 M37 V71 R75 V78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016055 Wnt signaling pathway

View graph for
Biological Process
External links
PDB RCSB:2mx6, PDBe:2mx6, PDBj:2mx6
PDBsum2mx6
PubMed
UniProtP51141|DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 (Gene Name=Dvl1)

[Back to BioLiP]