Structure of PDB 2mwo Chain A Binding Site BS01

Receptor Information
>2mwo Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGK
DILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKW
YKRMAVILSLEQGNRLREQYGLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mwo Structural Plasticity of Methyllysine Recognition by the Tandem Tudor Domain of 53BP1.
ResolutionN/A
Binding residue
(original residue number in PDB)
W1495 G1499 Y1502 D1521 Y1523 L1547 E1549 D1550 E1551 F1553 M1584
Binding residue
(residue number reindexed from 1)
W15 G19 Y22 D41 Y43 L67 E69 D70 E71 F73 M104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mwo, PDBe:2mwo, PDBj:2mwo
PDBsum2mwo
PubMed25579814
UniProtQ12888|TP53B_HUMAN TP53-binding protein 1 (Gene Name=TP53BP1)

[Back to BioLiP]