Structure of PDB 2mv7 Chain A Binding Site BS01

Receptor Information
>2mv7 Chain A (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCS
LDKTTVRKLQSYLETSGTS
Ligand information
>2mv7 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TNKLPVSIPLASVVLPSRAERARST
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mv7 Degree of Recruitment of DOT1L to MLL-AF9 Defines Level of H3K79 Di- and Tri-methylation on Target Genes and Transformation Potential.
ResolutionN/A
Binding residue
(original residue number in PDB)		L507 H511 R518 L523 Q524 I538 T541 T542 F543 D544 F545 D546 L547 C548
Binding residue
(residue number reindexed from 1)		L8 H12 R19 L24 Q25 I39 T42 T43 F44 D45 F46 D47 L48 C49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mv7, PDBe:2mv7, PDBj:2mv7
PDBsum2mv7
PubMed25921540
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]