Structure of PDB 2mqq Chain A Binding Site BS01

Receptor Information
>2mqq Chain A (length=215) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMV
EMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSY
KDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDEL
GVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPY
PYTLKLCFSTAQHAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mqq Structural Investigation of hnRNP L bound to RNA
ResolutionN/A
Binding residue
(original residue number in PDB)		M382 Y384 K410 M412 K413 K415 M420 N447 S451 K452 Q453 M457 G459 Q460
Binding residue
(residue number reindexed from 1)		M11 Y13 K39 M41 K42 K44 M49 N76 S80 K81 Q82 M86 G88 Q89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mqq, PDBe:2mqq, PDBj:2mqq
PDBsum2mqq
PubMed
UniProtF1LQ48|HNRPL_RAT Heterogeneous nuclear ribonucleoprotein L (Gene Name=Hnrnpl)

[Back to BioLiP]