Structure of PDB 2mqp Chain A Binding Site BS01

Receptor Information
>2mqp Chain A (length=118) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVI
FRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVF
KNDQDTWDYTNPNLSGQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mqp Structural Investigation of hnRNP L bound to RNA
ResolutionN/A
Binding residue
(original residue number in PDB)		V191 L193 T195 I196 V222 I223 F224 K226 N227 G228 V229 Q230 M232 E234 E263 Y264 A265 K266 P267 R269 L270 N271 V272 F273 K274 T279
Binding residue
(residue number reindexed from 1)		V18 L20 T22 I23 V49 I50 F51 K53 N54 G55 V56 Q57 M59 E61 E90 Y91 A92 K93 P94 R96 L97 N98 V99 F100 K101 T106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2mqp, PDBe:2mqp, PDBj:2mqp
PDBsum2mqp
PubMed
UniProtF1LQ48|HNRPL_RAT Heterogeneous nuclear ribonucleoprotein L (Gene Name=Hnrnpl)

[Back to BioLiP]