Structure of PDB 2mqo Chain A Binding Site BS01

Receptor Information
>2mqo Chain A (length=105) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKR
QALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDS
RSVNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mqo Structural Investigation of hnRNP L bound to RNA
ResolutionN/A
Binding residue
(original residue number in PDB)		H91 H100 R102 M129 K131 K132 Q134 L136 F165 N167 S169 T170 I174 S175
Binding residue
(residue number reindexed from 1)		H8 H17 R19 M46 K48 K49 Q51 L53 F82 N84 S86 T87 I91 S92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2mqo, PDBe:2mqo, PDBj:2mqo
PDBsum2mqo
PubMed
UniProtF1LQ48|HNRPL_RAT Heterogeneous nuclear ribonucleoprotein L (Gene Name=Hnrnpl)

[Back to BioLiP]