Structure of PDB 2mps Chain A Binding Site BS01

Receptor Information
>2mps Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKE
VLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTM
IYRNLVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mps Structural convergence of unstructured p53 family transactivation domains in MDM2 recognition
ResolutionN/A
Binding residue
(original residue number in PDB)		K51 L54 G58 I61 M62 Q72 F91 V93 K94 H96 I99 Y100
Binding residue
(residue number reindexed from 1)		K49 L52 G56 I59 M60 Q70 F89 V91 K92 H94 I97 Y98
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mps, PDBe:2mps, PDBj:2mps
PDBsum2mps
PubMed25591003
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]