Structure of PDB 2mpm Chain A Binding Site BS01

Receptor Information
>2mpm Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC
ADPKKKWVQDSMKYLDQKSPTPKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mpm Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
ResolutionN/A
Binding residue
(original residue number in PDB)		A14 N15 R16 K17 I18 R22 L45 K47 I49 K55
Binding residue
(residue number reindexed from 1)		A14 N15 R16 K17 I18 R22 L45 K47 I49 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0008009 chemokine activity
GO:0031728 CCR3 chemokine receptor binding
GO:0046983 protein dimerization activity
GO:0048018 receptor ligand activity
GO:0048020 CCR chemokine receptor binding
Biological Process
GO:0001938 positive regulation of endothelial cell proliferation
GO:0002544 chronic inflammatory response
GO:0002551 mast cell chemotaxis
GO:0006468 protein phosphorylation
GO:0006874 intracellular calcium ion homeostasis
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007010 cytoskeleton organization
GO:0007015 actin filament organization
GO:0007155 cell adhesion
GO:0007165 signal transduction
GO:0007611 learning or memory
GO:0008360 regulation of cell shape
GO:0009314 response to radiation
GO:0009615 response to virus
GO:0030335 positive regulation of cell migration
GO:0030838 positive regulation of actin filament polymerization
GO:0035962 response to interleukin-13
GO:0043547 positive regulation of GTPase activity
GO:0045766 positive regulation of angiogenesis
GO:0048245 eosinophil chemotaxis
GO:0050768 negative regulation of neurogenesis
GO:0060444 branching involved in mammary gland duct morphogenesis
GO:0060763 mammary duct terminal end bud growth
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070098 chemokine-mediated signaling pathway
GO:0070371 ERK1 and ERK2 cascade
GO:0070670 response to interleukin-4
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mpm, PDBe:2mpm, PDBj:2mpm
PDBsum2mpm
PubMed25450766
UniProtP51671|CCL11_HUMAN Eotaxin (Gene Name=CCL11)

[Back to BioLiP]