Structure of PDB 2moe Chain A Binding Site BS01

Receptor Information
>2moe Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANY
LHKNGETSLKPEDFDFTVLSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2moe Solution structure and intramolecular exchange of methyl-cytosine binding domain protein 4 (MBD4) on DNA suggests a mechanism to scan for mCpG/TpG mismatches.
ResolutionN/A
Binding residue
(original residue number in PDB)		R97 K101 T102 L116
Binding residue
(residue number reindexed from 1)		R20 K24 T25 L39
Binding affinityPDBbind-CN: Kd=6.4uM
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2moe, PDBe:2moe, PDBj:2moe
PDBsum2moe
PubMed25183517
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]