Structure of PDB 2mnz Chain A Binding Site BS01

Receptor Information
>2mnz Chain A (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPK
CLAQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mnz The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B.
ResolutionN/A
Binding residue
(original residue number in PDB)		V307 D308 S317 G318 N319 E321 L324 L325 L326 D328 P347 G349 W351
Binding residue
(residue number reindexed from 1)		V2 D3 S12 G13 N14 E16 L19 L20 L21 D23 P42 G44 W46
Enzymatic activity
Enzyme Commision number 1.14.11.67: [histone H3]-trimethyl-L-lysine(4) demethylase.
External links
PDB RCSB:2mnz, PDBe:2mnz, PDBj:2mnz
PDBsum2mnz
PubMed24952722
UniProtQ9UGL1|KDM5B_HUMAN Lysine-specific demethylase 5B (Gene Name=KDM5B)

[Back to BioLiP]