Structure of PDB 2mnu Chain A Binding Site BS01

Receptor Information
>2mnu Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFE
DFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
Ligand information
>2mnu Chain B (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSSPIQGSWTWENGKWTWKGIIRLEQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mnu An Unusual Protein-Protein Interaction through Coupled Unfolding and Binding
ResolutionN/A
Binding residue
(original residue number in PDB)		L12 F14 I17 I71 D72 Y73 I75 S76 V77 T79
Binding residue
(residue number reindexed from 1)		L10 F12 I15 I69 D70 Y71 I73 S74 V75 T77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mnu, PDBe:2mnu, PDBj:2mnu
PDBsum2mnu
PubMed24985319
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]