Structure of PDB 2mna Chain A Binding Site BS01

Receptor Information
>2mna Chain A (length=117) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVGDETGR
VKLTLWGKHAGSIKEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDG
FPESSQIPENTPTARRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mna The structural basis of DNA binding by the single-stranded DNA-binding protein from Sulfolobus solfataricus
ResolutionN/A
Binding residue
(original residue number in PDB)
R28 R37 T54 W56 W75 T77 F79 K80 Q84 N86 K90
Binding residue
(residue number reindexed from 1)
R28 R37 T54 W56 W75 T77 F79 K80 Q84 N86 K90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mna, PDBe:2mna, PDBj:2mna
PDBsum2mna
PubMed25367669
UniProtQ97W73|SSB_SACS2 Single-stranded DNA binding protein Ssb (Gene Name=ssb)

[Back to BioLiP]