Structure of PDB 2mkr Chain A Binding Site BS01

Receptor Information
>2mkr Chain A (length=115) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQA
TPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNI
KMTLQQIISRYKDAD
Ligand information
>2mkr Chain B (length=13) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLDESWDYIFETT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mkr Structural and Functional Characterization of a Complex between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 Subunit of TFIIH.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q49 T51 M59 R61 R86 M88
Binding residue
(residue number reindexed from 1)		Q49 T51 M59 R61 R86 M88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mkr, PDBe:2mkr, PDBj:2mkr
PDBsum2mkr
PubMed24675874
UniProtP32776|TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 (Gene Name=TFB1)

[Back to BioLiP]