Structure of PDB 2mkn Chain A Binding Site BS01

Receptor Information

>2mkn Chain A (length=44) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGR

Ligand information

>2mkn Chain B (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccguggucugguggccgg

...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2mkn Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
Resolution	N/A
Binding residue (original residue number in PDB)	V198 K208 K211 Q212 K215
Binding residue (residue number reindexed from 1)	V18 K28 K31 Q32 K35
Binding affinity	PDBbind-CN: Kd=8uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2mkn, PDBe:2mkn, PDBj:2mkn
PDBsum	2mkn
PubMed	24521053
UniProt	Q9UL40\|ZN346_HUMAN Zinc finger protein 346 (Gene Name=ZNF346)

[Back to BioLiP]