Structure of PDB 2mki Chain A Binding Site BS01

Receptor Information
>2mki Chain A (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESK
SYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIR
PWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCY
AGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKP
YVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mki A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
ResolutionN/A
Binding residue
(original residue number in PDB)		K66 F68 G71 P96 H97 Y110 F112 Y136 I144 K147 P148 Q150 R152 F176 R182 K215 G216 K251 V254
Binding residue
(residue number reindexed from 1)		K14 F16 G19 P44 H45 Y58 F60 Y84 I92 K95 P96 Q98 R100 F124 R130 K163 G164 K199 V202
Binding affinityPDBbind-CN: Kd=15.8uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0045182 translation regulator activity
Biological Process
GO:0006417 regulation of translation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2mki, PDBe:2mki, PDBj:2mki
PDBsum2mki
PubMed24990967
UniProtQ17RY0|CPEB4_HUMAN Cytoplasmic polyadenylation element-binding protein 4 (Gene Name=CPEB4)

[Back to BioLiP]