Structure of PDB 2mkc Chain A Binding Site BS01

Receptor Information
>2mkc Chain A (length=118) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGE
SQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE
AVKEELDRDIVSKNNAEK
Ligand information
>2mkc Chain B (length=23) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSKSQYIDIMPDFSPSGLLELES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mkc Cooperative structure of the heterotrimeric pre-mRNA retention and splicing complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		E21 L22 T23 E24 G25 D26 L28 T29 R44 E46 F75 I77 G78 L95 K97 Y98 V102
Binding residue
(residue number reindexed from 1)		E21 L22 T23 E24 G25 D26 L28 T29 R44 E46 F75 I77 G78 L95 K97 Y98 V102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2mkc, PDBe:2mkc, PDBj:2mkc
PDBsum2mkc
PubMed25218446
UniProtP40565|IST3_YEAST U2 snRNP component IST3 (Gene Name=IST3)

[Back to BioLiP]