Structure of PDB 2mjh Chain A Binding Site BS01

Receptor Information
>2mjh Chain A (length=142) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKI
MVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAA
LEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKSPNPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mjh Structural and functional implications of the QUA2 domain on RNA recognition by GLD-1.
ResolutionN/A
Binding residue
(original residue number in PDB)		N220 V222 G223 L226 G227 P228 R229 G230 A233 K234 K243 I244 M245 V246 R247 A260 R262 N266 W267 E307 G308 D310 K313 R314 L317 M318 L320 A321 Y327 R328 P329 M330
Binding residue
(residue number reindexed from 1)		N26 V28 G29 L32 G33 P34 R35 G36 A39 K40 K49 I50 M51 V52 R53 A66 R68 N72 W73 E113 G114 D116 K119 R120 L123 M124 L126 A127 Y133 R134 P135 M136
Binding affinityPDBbind-CN: Kd=0.061uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2mjh, PDBe:2mjh, PDBj:2mjh
PDBsum2mjh
PubMed24838563
UniProtQ17339|GLD1_CAEEL Female germline-specific tumor suppressor gld-1 (Gene Name=gld-1)

[Back to BioLiP]