Structure of PDB 2mgz Chain A Binding Site BS01

Receptor Information
>2mgz Chain A (length=94) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVT
MQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mgz RBFOX and SUP-12 sandwich a G base to cooperatively regulate tissue-specific splicing
ResolutionN/A
Binding residue
(original residue number in PDB)		R101 H103 S105 I107 F109 I131 I132 N134 R136 G137 S138 K139 G140 F141 F143 R167 N172 L173 A174 T175 Q176 R177
Binding residue
(residue number reindexed from 1)		R6 H8 S10 I12 F14 I36 I37 N39 R41 G42 S43 K44 G45 F46 F48 R72 N77 L78 A79 T80 Q81 R82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000381 regulation of alternative mRNA splicing, via spliceosome
GO:0007399 nervous system development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2mgz, PDBe:2mgz, PDBj:2mgz
PDBsum2mgz
PubMed25132178
UniProtG5EEW7

[Back to BioLiP]