Structure of PDB 2mfq Chain A Binding Site BS01

Receptor Information
>2mfq Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKW
HYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQN
NSINVVEEPVVERNN
Ligand information
>2mfq Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPDAVIIGMTKIPVIENPQYFGI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mfq Structural insights into FRS2 alpha PTB domain recognition by neurotrophin receptor TrkB.
ResolutionN/A
Binding residue
(original residue number in PDB)		V26 D28 D29 G30 Y59 L60 C61 L62 R63 R64 Y65 G66 Y67 D68 S69 L71 S73 G77 R78 I86 A88 K90 F98 Q102 M105 S109 I110
Binding residue
(residue number reindexed from 1)		V19 D21 D22 G23 Y52 L53 C54 L55 R56 R57 Y58 G59 Y60 D61 S62 L64 S66 G70 R71 I79 A81 K83 F91 Q95 M98 S102 I103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mfq, PDBe:2mfq, PDBj:2mfq
PDBsum2mfq
PubMed24470253
UniProtQ8WU20|FRS2_HUMAN Fibroblast growth factor receptor substrate 2 (Gene Name=FRS2)

[Back to BioLiP]