Structure of PDB 2mfc Chain A Binding Site BS01

Receptor Information
>2mfc Chain A (length=59) Species: 294 (Pseudomonas fluorescens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD
Ligand information
>2mfc Chain B (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggugucgacggauagacaccc
<<<<<<<........>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mfc Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.
ResolutionN/A
Binding residue
(original residue number in PDB)		M1 L2 I3 L4 T5 K7
Binding residue
(residue number reindexed from 1)		M1 L2 I3 L4 T5 K7
Binding affinityPDBbind-CN: Kd=1.9uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0006109 regulation of carbohydrate metabolic process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mfc, PDBe:2mfc, PDBj:2mfc
PDBsum2mfc
PubMed24561806
UniProtP0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)

[Back to BioLiP]