Structure of PDB 2me6 Chain A Binding Site BS01

Receptor Information
>2me6 Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQ
VKIWFQNRRAKWKRIKAGNVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2me6 NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens in complex with the DNA sequence CGACTAATTAGTCG
ResolutionN/A
Binding residue
(original residue number in PDB)		R8 R10 L34 R37 S38 K52 Q56 R59 K63
Binding residue
(residue number reindexed from 1)		R8 R10 L34 R37 S38 K52 Q56 R59 K63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2me6, PDBe:2me6, PDBj:2me6
PDBsum2me6
PubMed
UniProtQ14549|GBX1_HUMAN Homeobox protein GBX-1 (Gene Name=GBX1)

[Back to BioLiP]