Structure of PDB 2mc1 Chain A Binding Site BS01

Receptor Information
>2mc1 Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIK
YNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTT
LQFPFKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mc1 Differential recognition of syk-binding sites by each of the two phosphotyrosine-binding pockets of the Vav SH2 domain.
ResolutionN/A
Binding residue
(original residue number in PDB)		E677 R678 A679 R696 Q697 R698 E704 A706 K716 H717 K719 E731 K732 K755 S756
Binding residue
(residue number reindexed from 1)		E17 R18 A19 R36 Q37 R38 E44 A46 K56 H57 K59 E71 K72 K95 S96
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mc1, PDBe:2mc1, PDBj:2mc1
PDBsum2mc1
PubMed23955592
UniProtP15498|VAV_HUMAN Proto-oncogene vav (Gene Name=VAV1)

[Back to BioLiP]