Structure of PDB 2mc0 Chain A Binding Site BS01

Receptor Information
>2mc0 Chain A (length=143) Species: 1916 (Streptomyces lividans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDW
QRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYE
MHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP
Ligand information
>2mc0 Chain B (length=12) Species: 1885 (Streptomyces actuosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SCTTCECCCSCA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mc0 Structural basis and dynamics of multidrug recognition in a minimal bacterial multidrug resistance system
ResolutionN/A
Binding residue
(original residue number in PDB)		F126 Y131 V135 R138 W139 A144 Y145 C214 L215 M218 R224 F225 N228 I229
Binding residue
(residue number reindexed from 1)		F16 Y21 V25 R28 W29 A34 Y35 C104 L105 M108 R114 F115 N118 I119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mc0, PDBe:2mc0, PDBj:2mc0
PDBsum2mc0
PubMed25489067
UniProtP0A4T9|TIPA_STRLI HTH-type transcriptional activator TipA (Gene Name=tipA)

[Back to BioLiP]